PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01357.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 625aa    MW: 68276.5 Da    PI: 9.7416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01357.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-07189224136
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36 
                                     +g+WT+eEd++lv  +   G  +W+++++  g  R+
  Zmw_sc01357.1.g00080.1.am.mkhc 189 KGPWTAEEDQKLVSFILSNGRCCWRAVPKLAGASRS 224
                                     79****************************995554 PP

2Myb_DNA-binding52.51.1e-16272312547
                                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +  E++l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Zmw_sc01357.1.g00080.1.am.mkhc 272 SDAEEKLVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 312
                                     778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-17180263IPR009057Homeodomain-like
SuperFamilySSF466894.38E-10183269IPR009057Homeodomain-like
PROSITE profilePS500908.897184262IPR017877Myb-like domain
SMARTSM007172.5E-8188264IPR001005SANT/Myb domain
PfamPF002496.1E-6189224IPR001005SANT/Myb domain
CDDcd001671.62E-5191262No hitNo description
SuperFamilySSF466896.31E-21249322IPR009057Homeodomain-like
PROSITE profilePS5129426.833263317IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-24264317IPR009057Homeodomain-like
SMARTSM007172.0E-15267315IPR001005SANT/Myb domain
CDDcd001673.52E-12272313No hitNo description
PfamPF002492.3E-14272312IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MIAGPIVGDA SSASLDAKHV VGASTRRSSM EIDSHALTFC AQAAGLNSPN VAHAIVPTLV  60
STRGLLDAGL RKEGRRCVGQ RSGGRQGGDA QGTRKVEKGG EEQQKARRLS PILRGFPPDP  120
RENQPRSDTE TRRTDGTDRV KPDDTILGDY CMRLAAGVVR PVPCSPPPPP PLLPYKGRQP  180
CCDKVGLKKG PWTAEEDQKL VSFILSNGRC CWRAVPKLAG ASRSLPRSPK FLCVWRRIDP  240
TTDSAGLLRC GKSCRLRWTN YLRPDLKRGL LSDAEEKLVI DLHAQLGNRW SKIASHLPGR  300
TDNEIKNHWN THIKKKLRKM GIDPLTHKPL QPTDHHHQQQ EQLPPAEARP PKPEHQRQPT  360
PNTLTIEAAA TSSQQEEEQP PLLSKSPGFC TDEVPMIHPD EIIVPAQDDQ RLLRPTPTCA  420
TATASPPPTS YSASASSSCD EEAALFPAVD EWPDATCLMG LDDMIATAPP APWVDEWPVQ  480
PPSPVFADPC FGAYTHQRAA ADVEEPLGRG RAQRLRVAVA QARARSAAVT RAPLRTRGQG  540
RRAASRGRRL ITRVQAGVVA RAQAATCTRG QRGLGSRGLG QAQEGSSWRM QAVTNHERPG  600
RSACCSLAET WKQHNEKLYS IRLDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-241873175108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1545552RGRRLITR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572214.11e-102PREDICTED: protein ODORANT1
TrEMBLI1I7771e-102I1I777_BRADI; Uncharacterized protein
STRINGBRADI3G36370.11e-102(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563